The domain within your query sequence starts at position 44 and ends at position 289; the E-value for the UMPH-1 domain shown below is 6.2e-126.
MTLSRFAYNGQRCPSSHNILDNSKIISEDCRKELTELFHHYYPIEIDPHRTIKEKLPHMV QWWSKAHSLLCQQRIQKVQIAQVVGESTAMLREGYKTFFDTLYQNNIPLFIFSAGIGDIL EEIIRQMKVFHPNIHIVSNYMDFSEDGFLKGFKGQLIHTYNKNSSVCENSSYFQQLQNKT NIILLGDSIGDLTMADGVPGVQNILKIGFLNDKVEERRERYMDSYDIVLEKDETLDVVNG LLRHIL
UMPH-1 |
![]() |
---|
PFAM accession number: | PF05822 |
---|---|
Interpro abstract (IPR006434): | This family is a small group of metazoan sequences with sequences from Arabidopsis thaliana (Mouse-ear cress) and rice. The sequences represent pyrimidine 5-nucleotidases, apparently in reference to HSPC233, the Homo sapiens (Human) homologue [ (PUBMED:10942414) ]. The structure of mouse sequence has been reported [ (PUBMED:16672222) ]. This group of sequences was originally found during searches for members of the haloacid dehalogenase (HAD) superfamily. All of the conserved catalytic motifs [ (PUBMED:7966317) ] are found. The placement of the variable domain between motifs 1 and 2 indicates membership in subfamily I of the superfamily, but these sequences are sufficiently different from any of the branches of that subfamily (IA-ID) as to constitute a separate branch to now be called IE. Considering that the closest identifiable hit outside of the noise range is to a phosphoserine phosphatase, this group may be considered to be most closely allied to subfamily IB. |
GO component: | cytoplasm (GO:0005737) |
GO function: | magnesium ion binding (GO:0000287), 5'-nucleotidase activity (GO:0008253) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UMPH-1