SMART: Pfam domain UNC80

The domain within your query sequence starts at position 16 and ends at position 236; the E-value for the UNC80 domain shown below is 2.2e-94.

RGIPLPIQTFLWRQTSAFLRPKLGKQYEASCVSFERVLVENKLHGLSPALSEAIQSISRW
ELVQAALPHVLHCTATLLSNRNKLGHQDKLGVAETKLLHTLHWMLLEAPQDCNNDQFGGT
DRGSSWGGSSSAFIHQIENQGSPGQPCRSSSHDEEENNRRKTFQNSMATVELFVFLFAPL
VHRIKESDLTFRLASGLVIWQPMWEHRQPEVSGFTALVKPI

UNC80

PFAM accession number:	PF15778
Interpro abstract (IPR031542):	UNC80 is a protein associated with the NALCN sodium channel complex, and is required for the activation of this channel by the neuropeptide substance P. NALCN activation is G-protein-independent, but requires Src kinases. NUNC80 binds Src kinases and recruits Src into the channel complex [ (PUBMED:19535918) ]. UNC80 is required for the proper localisation of C. elegans NCA-1 and NCA-2, the homologues of the vertebrate cation leak channel NALCN [ (PUBMED:17825559) ]. NCA-1 and UNC-80 regulate neuronal activity in C. elegans [ (PUBMED:18336069) ]. This entry represents the N-terminal domain of UNC80.

PFAM accession number:

PF15778

Interpro abstract (IPR031542):

UNC80 is a protein associated with the NALCN sodium channel complex, and is required for the activation of this channel by the neuropeptide substance P. NALCN activation is G-protein-independent, but requires Src kinases. NUNC80 binds Src kinases and recruits Src into the channel complex [ (PUBMED:19535918) ]. UNC80 is required for the proper localisation of C. elegans NCA-1 and NCA-2, the homologues of the vertebrate cation leak channel NALCN [ (PUBMED:17825559) ]. NCA-1 and UNC-80 regulate neuronal activity in C. elegans [ (PUBMED:18336069) ].

This entry represents the N-terminal domain of UNC80.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UNC80