The domain within your query sequence starts at position 16 and ends at position 236; the E-value for the UNC80 domain shown below is 2.2e-94.
RGIPLPIQTFLWRQTSAFLRPKLGKQYEASCVSFERVLVENKLHGLSPALSEAIQSISRW ELVQAALPHVLHCTATLLSNRNKLGHQDKLGVAETKLLHTLHWMLLEAPQDCNNDQFGGT DRGSSWGGSSSAFIHQIENQGSPGQPCRSSSHDEEENNRRKTFQNSMATVELFVFLFAPL VHRIKESDLTFRLASGLVIWQPMWEHRQPEVSGFTALVKPI
UNC80 |
---|
PFAM accession number: | PF15778 |
---|---|
Interpro abstract (IPR031542): | UNC80 is a protein associated with the NALCN sodium channel complex, and is required for the activation of this channel by the neuropeptide substance P. NALCN activation is G-protein-independent, but requires Src kinases. NUNC80 binds Src kinases and recruits Src into the channel complex [ (PUBMED:19535918) ]. UNC80 is required for the proper localisation of C. elegans NCA-1 and NCA-2, the homologues of the vertebrate cation leak channel NALCN [ (PUBMED:17825559) ]. NCA-1 and UNC-80 regulate neuronal activity in C. elegans [ (PUBMED:18336069) ]. This entry represents the N-terminal domain of UNC80. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UNC80