The domain within your query sequence starts at position 1 and ends at position 80; the E-value for the UN_NPL4 domain shown below is 7e-38.
MAESIIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASS SKSLHLLKIKHGDLLFLFPS
UN_NPL4 |
---|
PFAM accession number: | PF11543 |
---|---|
Interpro abstract (IPR024682): | Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway. Npl4 has a N-terminal ubiquitin-like domain which has within its structure a beta-grasp fold with a helical insert [ (PUBMED:17491009) ]. This entry represents the ubiquitin-like domain. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UN_NPL4