The domain within your query sequence starts at position 142 and ends at position 224; the E-value for the UPAR_LY6 domain shown below is 1.3e-16.
CYSCVGLSREKCQGSMPPVVNCYNASGRVYKGCFDGNVTLTAANVTVSLPVRGCVQDETC TRDGVTGPGFTLSGSCCQGPRCN
UPAR_LY6 |
![]() |
---|
PFAM accession number: | PF00021 |
---|---|
Interpro abstract (IPR016054): | A variety of GPI-linked cell-surface glycoproteins are composed of one or more copies of a conserved domain of about 100 amino-acid residues [ (PUBMED:1850423) (PUBMED:8394346) ]. Among these proteins, U-PAR contains three tandem copies of the domain, while all the others are made up of a single domain. As shown in the following schematic, this conserved domain contains 10 cysteine residues involved in five disulphide bonds - in U-PAR, the first copy of the domain lacks the fourth disulphide bond.
This entry represents a three-fold repeated domain in urokinase-type plasminogen activator receptor (uPAR) that occurs singly in other GPI-linked cell-surface glycoproteins (Ly-6 family, CD59, thymocyte B cell antigen, Sgp-2). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPAR_LY6