The domain within your query sequence starts at position 98 and ends at position 171; the E-value for the UPF0016 domain shown below is 1.4e-25.
VAAISVIIVSELGDKTFFIAAIMAMRYNRLTVLAGAMLALALMTCLSVLFGYATTVIPRV YTYYVSTALFAIFG
UPF0016 |
---|
PFAM accession number: | PF01169 |
---|---|
Interpro abstract (IPR001727): | Budding yeast Gdt1 is a Golgi-localized calcium transporter required for stress-induced calcium signalling and protein glycosylation [ (PUBMED:27075443) ]. Its human homologue, TMEM165, may be a Golgi Ca2(+)/H(+) antiporter [ (PUBMED:24530912) ]. Defects in the human protein TMEM165 cause a subtype of Congenital Disorders of Glycosylation [ (PUBMED:23569283) ]. In Arabidopsis this protein is variously known as CCHA1 (a chloroplast-localized potential Ca(2+)/H(+) antiporter), chloroplastic PAM71 (photosynthesis affected mutant 71), and GDT1-like protein 1, chloroplastic. It has been reported to be a putative chloroplast-localized Ca(2+)/H(+) antiporter with critical functions in the regulation of PSII and in chloroplast Ca(2+) and pH homeostasis [ (PUBMED:27302341) ]. It has also been suggested that it may function in Mn(2+) uptake into thylakoids, ensuring optimal PSII performance [ (PUBMED:27020959) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0016