SMART: Pfam domain UPF0029

The domain within your query sequence starts at position 180 and ends at position 288; the E-value for the UPF0029 domain shown below is 8.5e-36.

DRRSTFQAHVAPVVCPEQVKLVLAKLYENKKIASATHNIYAYRIFCEDKQTFLQDCEDDG
ETAAGGRLLHLMEILNVKNVMVVVSRWYGGILLGPDRFKHINNCARNIL

UPF0029

PFAM accession number:	PF01205
Interpro abstract (IPR001498):	The Impact protein is a translational regulator that ensures constant high levels of translation under amino acid starvation. It acts by interacting with Gcn1/Gcn1L1, thereby preventing activation of Gcn2 protein kinases (EIF2AK1 to 4) and subsequent down-regulation of protein synthesis. It is evolutionary conserved from eukaryotes to archaea [ (PUBMED:11116084) ]. This entry represents the N-terminal domain of the Impact proteins.

PFAM accession number:

PF01205

Interpro abstract (IPR001498):

The Impact protein is a translational regulator that ensures constant high levels of translation under amino acid starvation. It acts by interacting with Gcn1/Gcn1L1, thereby preventing activation of Gcn2 protein kinases (EIF2AK1 to 4) and subsequent down-regulation of protein synthesis. It is evolutionary conserved from eukaryotes to archaea [ (PUBMED:11116084) ].

This entry represents the N-terminal domain of the Impact proteins.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0029