The domain within your query sequence starts at position 13 and ends at position 161; the E-value for the UPF0183 domain shown below is 2.8e-65.
GNEQWEFTLGMPLAQAVAILQKHCRIIRNVQVLYSEQSPLSHDLILNLTQDGITLLFDAF NQRLKVIEVCELTKVKLKYCGVHFNSQAIAPTIEQIDQSFGATHPGVYNSTEQLFHLNFR GLSFSFQLDSWTEAPKYEGSCDALELFPG
UPF0183 |
![]() |
---|
PFAM accession number: | PF03676 |
---|---|
Interpro abstract (IPR005373): | Members of this family are proteins of unknown function. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0183