SMART: Pfam domain UPF0203

The domain within your query sequence starts at position 1 and ends at position 70; the E-value for the UPF0203 domain shown below is 1.1e-30.

MNSVGEACTDMKREYDQCFNRWFAEKFLKGDGSGDPCTDLFKRYQQCVQKAIKEKEIPIE
GLEFMGHGKE

UPF0203

PFAM accession number:	PF05254
Interpro abstract (IPR007918):	This is a family of small highly conserved proteins. In Saccharomyces cerevisiae (Baker's yeast) the gene YKL053C-A (MDM35) O60200 is one of the genes essential for maintenance of normal mitochondrial distribution and morphology (MDM) [ (PUBMED:11907266) ]; wherease in Homo sapiens (Human), p53CSV, O43715 is a direct transcriptional target for p53 and appears to be a cell-survival mediator in response to genotoxic stress including low-levels of DNA damage. It is suggested that p53CSV modulates the apoptotic pathway through interaction with HSP70 and Apaf-1 thereby inhibiting activation of procaspase-3 and procaspase-9 [ (PUBMED:15735003) ].

PFAM accession number:

PF05254

Interpro abstract (IPR007918):

This is a family of small highly conserved proteins. In Saccharomyces cerevisiae (Baker's yeast) the gene YKL053C-A (MDM35) O60200 is one of the genes essential for maintenance of normal mitochondrial distribution and morphology (MDM) [ (PUBMED:11907266) ]; wherease in Homo sapiens (Human), p53CSV, O43715 is a direct transcriptional target for p53 and appears to be a cell-survival mediator in response to genotoxic stress including low-levels of DNA damage. It is suggested that p53CSV modulates the apoptotic pathway through interaction with HSP70 and Apaf-1 thereby inhibiting activation of procaspase-3 and procaspase-9 [ (PUBMED:15735003) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0203