The domain within your query sequence starts at position 14 and ends at position 88; the E-value for the UPF0560 domain shown below is 2.7e-8.
APLDATAGPSLIPDLITRIPWPRWTLFIAILAAGVLLVSCLLCVICCYCHRHRHRKQPKD KETVGLGSARNSTTT
UPF0560 |
![]() |
---|
PFAM accession number: | PF10577 |
---|---|
Interpro abstract (IPR018890): | This family of proteins has no known function. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0560