The domain within your query sequence starts at position 1 and ends at position 126; the E-value for the UPF0561 domain shown below is 4.4e-67.
MEAAQDHGPGLCCKPGGRLDMSHGFVHHIRRNQLDRDDYDKKVKQAAKEKARRRHTPAPT RPRKPDLQVYLPRHRDGSTHPVNPDCEEASESSSSGSSELEPPGRQLFCLDYEADSGEVT SVIVYQ
UPF0561 |
![]() |
---|
PFAM accession number: | PF10573 |
---|---|
Interpro abstract (IPR018888): | This family of proteins has no known function. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0561