The domain within your query sequence starts at position 15 and ends at position 112; the E-value for the UPF0697 domain shown below is 1.1e-53.
DDGSIDYTVHEAWNEATNVYLIVILVSFGLFMYAKRNKRKIMRIFSVPPTEGMLSEPSFY DTVSRIRLRQQVEAHPVSRKYEYQQPQSQADSVQLSLE
UPF0697 |
 |
|---|
| PFAM accession number: | PF15117 |
|---|---|
| Interpro abstract (IPR029368): | This family of uncharacterised proteins is found mostly in vertebrates. Proteins in this family are typically around 100 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0697