The domain within your query sequence starts at position 9 and ends at position 107; the E-value for the UPF0697 domain shown below is 4.1e-56.
ADDGSIDYTVHEAWNEATNVYLIVILVSFGLFMYAKRNKRKIMRIFSVPPTEGMLSEPSF YDTVSRIRLRQQVEAHPVSRKYEYQQPQSQADSVQLSLE
UPF0697 |
---|
PFAM accession number: | PF15117 |
---|---|
Interpro abstract (IPR029368): | This family of uncharacterised proteins is found mostly in vertebrates. Proteins in this family are typically around 100 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0697