The domain within your query sequence starts at position 1 and ends at position 89; the E-value for the UPF0728 domain shown below is 1.2e-44.
MPAQAVVTLRYGPYSAVGLSVEHRTYRLQGLQAVLAKDGHQIILEQIEDWNLVELVVNEE TVFQCDIQELEFGGDGKLDPLCEEARIAV
UPF0728 |
 |
|---|
| PFAM accession number: | PF15092 |
|---|---|
| Interpro abstract (IPR027885): | This family of proteins is functionally uncharacterised. This family of proteins is found in metazoa. There is a conserved GPY sequence motif. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0728