The domain within your query sequence starts at position 137 and ends at position 315; the E-value for the USP8_interact domain shown below is 2.3e-91.
HLRSVVQQQQSRIAELEKTSAEHKHQLAEQKRDIQLLKAYMRAIRSVNPNLQNLEETIEY NEILEWVNSLQPARVTRWGGMISTPDAVLQAVIKRSLVESGCPASIVNELIENAHERSWP QGLATLETRQMNRRYYENYVAKRIPGKQAVVVMACENQHMGDDMVQEPGLVMIFAHGVE
USP8_interact |
![]() |
---|
PFAM accession number: | PF08941 |
---|---|
Interpro abstract (IPR015036): | NRDP1 acts as E3 ubiquitin-protein ligase and regulates the degradation of target proteins [ (PUBMED:12411582) (PUBMED:19483718) ]. |
GO process: | protein ubiquitination (GO:0016567) |
GO function: | ubiquitin protein ligase activity (GO:0061630) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry USP8_interact