The domain within your query sequence starts at position 2 and ends at position 77; the E-value for the Ubiq-Cytc-red_N domain shown below is 6.4e-30.
LSVAARSGPFAPVLSATSRGVAGALRPLLQGAVPAASEPPVLDVKRPFLCRESLSGQAAA RPLVATVGLNVPASVR
Ubiq-Cytc-red_N |
 |
|---|
| PFAM accession number: | PF09165 |
|---|---|
| Interpro abstract (IPR015248): | The N-terminal domain of the ubiquinol-cytochrome c reductase iron-sulphur subunit adopts a structure consisting of many antiparallel beta sheets, with few alpha helices, in a non-globular arrangement. They are required for proper functioning of the respiratory chain [ (PUBMED:12269811) ]. |
| GO process: | oxidation-reduction process (GO:0055114) |
| GO function: | ubiquinol-cytochrome-c reductase activity (GO:0008121) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ubiq-Cytc-red_N