The domain within your query sequence starts at position 628 and ends at position 711; the E-value for the Ubiquitin_3 domain shown below is 2.4e-9.
PNAPLKRVLAYTGCFSRMQTIKEIHEYLSQRLRIKEEDMRLWLYNSENYLTLLDDEDHRL EYLKIQDEQHLVIEVRNKDMSWPE
Ubiquitin_3 |
---|
PFAM accession number: | PF14836 |
---|---|
Interpro abstract (IPR028135): | This ubiquitin-like (UBL) domain is found in several ubiquitin carboxyl-terminal hydrolases, also known as ubiquitin specific proteases (USP) [ (PUBMED:21848306) ], and in gametogenetin-binding protein. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ubiquitin_3