The domain within your query sequence starts at position 2 and ends at position 81; the E-value for the UcrQ domain shown below is 3.7e-37.

GREFGNLARIRHVISYSLSPFEQRAFPSYFSKGIPNVLRRTRERILRVAPPFVVVYLIYT
WGNQEFEQSKRKNPAMYEND

UcrQ

 UcrQ
PFAM accession number:PF02939
Interpro abstract (IPR004205):

The ubiquinol-cytochrome C reductase complex (cytochrome bc1 complex) is a respiratory multi-enzyme complex [ (PUBMED:9651245) ], which recognises a mitochondrial targeting presequence. The bc1 complex contains 11 subunits: 3 respiratory subunits (cytochrome b, cytochrome c1 and Rieske protein), 2 core proteins and 6 low molecular weight proteins. This family represents the 9.5kDa subunit of the complex, known as subunit 8 or protein QP-C [ (PUBMED:12709789) ]. This subunit together with cytochrome B binds to ubiquinone.

GO function:ubiquinol-cytochrome-c reductase activity (GO:0008121)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UcrQ