The domain within your query sequence starts at position 459 and ends at position 528; the E-value for the UnbV_ASPIC domain shown below is 8.9e-18.
ARGAKVVLYTKKSGAHLRIIDGGSGYLCEMEPVAHFGLGRDEASSVEVTWPDGKMVSRSV ASEEMNSVLE
UnbV_ASPIC |
 |
|---|
| PFAM accession number: | PF07593 |
|---|---|
| Interpro abstract (IPR011519): | This conserved sequence is found associated with IPR001440 in several paralogous proteins in Rhodopirellula baltica. It is also found associated with IPR000413 in several eukaryotic integrin-like proteins (e.g. human ASPIC Q9NQ78 ) and in several other bacterial proteins (e.g. Q84HN1 ) [ (PUBMED:12536216) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UnbV_ASPIC