The domain within your query sequence starts at position 85 and ends at position 316; the E-value for the Urocanase domain shown below is 1.4e-102.
MRAYPIDQYPCRTRAAAAIMHMIMNNLDPAVAQFPQELVTYGGNGQVFSNWAQFRLTMSY LSKMTEEQTLVMYSGHPLGLFPSSPRAPRLVITNGMVIPNYSSRTEYEKLFALGVTMYGQ MTAGSYCYIGPQGIVHGTVLTVLNAGRRYLGIENLAGKVFVTSGLGGMSGAQAKAAAIVG CIGVIAEVDKAALVKRHRQGWLMEVTDSLDRCIARLRYGLAVWDPEHLTLST
Urocanase |
![]() |
---|
PFAM accession number: | PF01175 |
---|---|
Interpro abstract (IPR035085): | Urocanase [ (PUBMED:7944380) ] (also known as imidazolonepropionate hydrolase or urocanate hydratase) is the enzyme that catalyses the second step in the degradation of histidine, the hydration of urocanate into imidazolonepropionate: This entry represents the central domain, with a rossmann-like fold, found in Urocanase. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Urocanase