The domain within your query sequence starts at position 3 and ends at position 107; the E-value for the V-ATPase_G domain shown below is 2e-41.
SQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKAKEAAA LGSHGSCSSEVEKETREKMTVLQNYFEQNRDEVLDNLLAFVCDIR
V-ATPase_G |
![]() |
---|
PFAM accession number: | PF03179 |
---|---|
Interpro abstract (IPR005124): | This family represents the eukaryotic vacuolar (H+)-ATPase (V-ATPase) G subunit. V-ATPases generate an acidic environment in several intracellular compartments. Correspondingly, they are found as membrane-attached proteins in several organelles. They are also found in the plasma membranes of some specialised cells. V-ATPases consist of peripheral (V1) and membrane integral (V0) heteromultimeric complexes. The G subunit is part of the V1 subunit, but is also thought to be strongly attached to the V0 complex. It may be involved in the coupling of ATP degradation to H+ translocation. |
GO process: | proton transmembrane transport (GO:1902600) |
GO component: | vacuolar proton-transporting V-type ATPase complex (GO:0016471) |
GO function: | ATPase-coupled transmembrane transporter activity (GO:0042626) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry V-ATPase_G