The domain within your query sequence starts at position 8 and ends at position 137; the E-value for the V-set_CD47 domain shown below is 2.2e-46.
LLLGSCCCGSAQLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFI YDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIEL KNRTAFNTDQ
V-set_CD47 |
![]() |
---|
PFAM accession number: | PF08204 |
---|---|
Interpro abstract (IPR013270): | This family represents the CD47 leukocyte antigen V-set like Ig domain [ (PUBMED:12124426) (PUBMED:8794870) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry V-set_CD47