The domain within your query sequence starts at position 1849 and ends at position 1973; the E-value for the VBS domain shown below is 6.2e-67.
SFVDYQTTMVRTAKAIAVTVQEMVTKSNTSPEELGPLANQLTSDYGRLASQAKPAAVAAE NEEIGAHIKHRVQELGHGCSALVTKAGALQCSPSDVYTKKELIECARRVSEKVSHVLAAL QAGNR
VBS |
![]() |
---|
PFAM accession number: | PF08913 |
---|---|
Interpro abstract (IPR015009): | Vinculin binding sites are predominantly found in talin and talin-like molecules, enabling binding of vinculin to talin, stabilising integrin-mediated cell-matrix junctions [ (PUBMED:20399778) ]. Talin, in turn, links integrins to the actin cytoskeleton. The consensus sequence for Vinculin binding sites is LxxAAxxVAxxVxxLIxxA, with a secondary structure prediction of four amphipathic helices. The hydrophobic residues that define the VBS are themselves 'masked' and are buried in the core of a series of helical bundles that make up the talin rod [ (PUBMED:16460027) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry VBS