SMART: Pfam domain VEFS-Box

The domain within your query sequence starts at position 548 and ends at position 682; the E-value for the VEFS-Box domain shown below is 3e-57.

SEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSD
VNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHD
FNLISIMSIDKAVTK

VEFS-Box

PFAM accession number:	PF09733
Interpro abstract (IPR019135):	The VEFS-Box is found in the the C-terminal region of the VRN2, EMF2, FIS2, and Su(z)12 polycomb proteins. This domain is characterised by an acidic cluster and a tryptophan/methionine-rich sequence, the acidic-W/M domain [ (PUBMED:11701882) ]. In some proteins the VEFS-Box is associated with a zinc-finger domain located roughly 100 residues towards the N terminus. These proteins are part of the polycomb cluster of proteins which control HOX gene transcription as it functions in heterochromatin-mediated repression [ (PUBMED:11546753) ].

PFAM accession number:

PF09733

Interpro abstract (IPR019135):

The VEFS-Box is found in the the C-terminal region of the VRN2, EMF2, FIS2, and Su(z)12 polycomb proteins. This domain is characterised by an acidic cluster and a tryptophan/methionine-rich sequence, the acidic-W/M domain [ (PUBMED:11701882) ]. In some proteins the VEFS-Box is associated with a zinc-finger domain located roughly 100 residues towards the N terminus. These proteins are part of the polycomb cluster of proteins which control HOX gene transcription as it functions in heterochromatin-mediated repression [ (PUBMED:11546753) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry VEFS-Box