The domain within your query sequence starts at position 4 and ends at position 189; the E-value for the VGLL4 domain shown below is 1.1e-67.
PLDVLSRAASLVHADDEKREASLRGEPRMQTLPVASALSSHRTGPPPISPSKRKFSMEPG DKDLDCENDHVSKMSRIFSPHLNKTVNGDCRRDPRERSRSPIERAAAPAVSLHGGHLYAS LPSLMEQPLALTKNSSDTGRSAVERQQNRPSVITCASAGARNCNLSHCPIAHSGCSAPGS ASYRR
VGLL4 |
![]() |
---|
PFAM accession number: | PF15245 |
---|---|
Interpro abstract (IPR028184): | Transcription cofactor vestigial-like protein 4 (Vgl-4) is a member of the Vgl family of TEF-1 (transcriptional enhancer factor-1) cofactors. Vgl-4 has two TDU motifs and is the only Vgl member expressed in the heart [ (PUBMED:15140898) ]. Vgl-4 modulates the activity of TEF-1 factors and counteracts alpha1-adrenergic activation of gene expression in cardiac myocytes [ (PUBMED:15140898) ]. |
GO process: | regulation of transcription, DNA-templated (GO:0006355) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry VGLL4