The domain within your query sequence starts at position 131 and ends at position 353; the E-value for the VPS13 domain shown below is 9.6e-57.
EPYWYSVTASVVTRIVENIELKIQDVHLRFEDGVTNPSRPFAFGICIKNVSMQNAANEPV QKLMRKKRLDVAEFSIYWDVNCTLLGDLPQAELQEAMARSMESRSHHYILEPVCASALLK RNCSKEPLRSRHSPRIECDIQLETIPLKLSQLQYRQIMAFLKELERKERQLKFRKWKPKV AVSKNCREWWYFALNANLYEIREQRKCWTWDFLLHRARDAVFY
VPS13 |
![]() |
---|
PFAM accession number: | PF16908 |
---|---|
Interpro abstract (IPR031646): | This domain is found in eukaryotic vacuolar sorting-associated 13 (VPS13) proteins. It lies towards the N terminus, just downstream from IPR026854 . The exact function of this domain is not known [ (PUBMED:15498460) (PUBMED:21764909) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry VPS13