The domain within your query sequence starts at position 374 and ends at position 471; the E-value for the Vasculin domain shown below is 1.3e-46.

QTDVLSSSLEAEHRLLKEMGWQEDSENDETCAPLTEDEMREFQVISEQLQKNGLRKNGIL
KNGLICDFKFGPWKNSTFKPTIENDDTETSSSDTSDDD

Vasculin

Vasculin
PFAM accession number:PF15337
Interpro abstract (IPR028128):

Vasculin (also known as GC-rich promoter-binding protein, GPBP) functions as a GC-rich promoter-specific transcription factor [ (PUBMED:14612417) ]. This protein also binds RNA, which may mediate different RNA-dependent cellular processes [ (PUBMED:26156556) ].

GO process:transcription, DNA-templated (GO:0006351), positive regulation of transcription, DNA-templated (GO:0045893)
GO component:nucleus (GO:0005634)
GO function:RNA binding (GO:0003723), DNA binding (GO:0003677)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Vasculin