The domain within your query sequence starts at position 377 and ends at position 470; the E-value for the Vasculin domain shown below is 1.3e-44.
GEVLSHSLEAEHRLLKAMGWQEYPENDESCLPLTEDELKEFHLRTEQLRRNGFGKNGLLQ SRSCSLSSPWRSTCIAECEDSDSETSSSQTSDDD
Vasculin |
![]() |
---|
PFAM accession number: | PF15337 |
---|---|
Interpro abstract (IPR028128): | Vasculin (also known as GC-rich promoter-binding protein, GPBP) functions as a GC-rich promoter-specific transcription factor [ (PUBMED:14612417) ]. This protein also binds RNA, which may mediate different RNA-dependent cellular processes [ (PUBMED:26156556) ]. |
GO process: | transcription, DNA-templated (GO:0006351), positive regulation of transcription, DNA-templated (GO:0045893) |
GO component: | nucleus (GO:0005634) |
GO function: | DNA binding (GO:0003677), RNA binding (GO:0003723) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Vasculin