The domain within your query sequence starts at position 122 and ends at position 163; the E-value for the Vault domain shown below is 5.4e-18.

QVVLPNTALHLKALLDFEDKNGDKVMAGDEWLFEGPGTYIPQ

Vault

• PFAM accession number: PF01505
• Interpro abstract (IPR041139):

  The vault is a ubiquitous and highly conserved ribonucleoprotein particle of approximately 13 mDa of unknown function [ (PUBMED:10196123) ]. This entry corresponds to a repeated domain found in the amino terminal half of the major vault protein.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Vault