The domain within your query sequence starts at position 247 and ends at position 414; the E-value for the Vert_HS_TF domain shown below is 6e-65.
YSSSSLYSSDAVTSSGPIISDITELAPTSPLASPGRSIDERPLSSSTLVRVKQEPPSPPH SPRVLEASPGRPSSMDTPLSPTAFIDSILRESEPTPAASNTAPMDTTGAQAPALPTPSTP EKCLSVACLDKNELSDHLDAMDSNLDNLQTMLTSHGFSVDTSALLDIQ
Vert_HS_TF |
---|
PFAM accession number: | PF06546 |
---|---|
Interpro abstract (IPR010542): | This domain represents the C-terminal region of vertebrate heat shock transcription factors. Heat shock transcription factors regulate the expression of heat shock proteins - a set of proteins that protect the cell from damage caused by stress and aid the cell's recovery after the removal of stress [ (PUBMED:11509572) ]. This C-terminal region is found with the N-terminal IPR000232 and may contain a three-stranded coiled-coil trimerisation domain and a CE2 regulatory region, the latter of which is involved in sustained heat shock response [ (PUBMED:11509572) ]. |
GO process: | regulation of transcription, DNA-templated (GO:0006355) |
GO function: | DNA-binding transcription factor activity (GO:0003700), DNA binding (GO:0003677) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Vert_HS_TF