The domain within your query sequence starts at position 247 and ends at position 414; the E-value for the Vert_HS_TF domain shown below is 6e-65.

YSSSSLYSSDAVTSSGPIISDITELAPTSPLASPGRSIDERPLSSSTLVRVKQEPPSPPH
SPRVLEASPGRPSSMDTPLSPTAFIDSILRESEPTPAASNTAPMDTTGAQAPALPTPSTP
EKCLSVACLDKNELSDHLDAMDSNLDNLQTMLTSHGFSVDTSALLDIQ

Vert_HS_TF

• PFAM accession number: PF06546
• Interpro abstract (IPR010542):

  This domain represents the C-terminal region of vertebrate heat shock transcription factors. Heat shock transcription factors regulate the expression of heat shock proteins - a set of proteins that protect the cell from damage caused by stress and aid the cell's recovery after the removal of stress [ (PUBMED:11509572) ]. This C-terminal region is found with the N-terminal IPR000232 and may contain a three-stranded coiled-coil trimerisation domain and a CE2 regulatory region, the latter of which is involved in sustained heat shock response [ (PUBMED:11509572) ].

• GO process: regulation of transcription, DNA-templated (GO:0006355)
• GO function: DNA-binding transcription factor activity (GO:0003700), DNA binding (GO:0003677)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Vert_HS_TF