The domain within your query sequence starts at position 405 and ends at position 469; the E-value for the VitD-bind_III domain shown below is 7.2e-36.

EMCADYSENTFTEYKKKLAERLRTKTPNTSPAELKDMVEKHSDFASKCCSINSPPLYCSS
QIDAE

VitD-bind_III

VitD-bind_III
PFAM accession number:PF09164
Interpro abstract (IPR015247):

This domain is predominantly found in Vitamin D binding proteins, and adopts a multihelical structure. It is required for formation of an actin 'clamp', allowing the protein to bind to actin [ (PUBMED:12048248) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry VitD-bind_III