The domain within your query sequence starts at position 71 and ends at position 177; the E-value for the WBP-1 domain shown below is 1.4e-50.
YLCETGHCCGETGCCTYYYELWWFWLLWTVLILFSCCCAFRHRRAKLRLQQQQRQREINL LAYHGACHGAGPVPTGSLLDLRLLSAFKPPAYEDVVHHPGTPPPPYT
WBP-1 |
 |
|---|
| PFAM accession number: | PF11669 |
|---|---|
| Interpro abstract (IPR021684): | This entry includes WBP-1 and its homologous. WBP-1 is a ligand of the WW domain of Yes-associated protein. This protein has a proline-rich domain. WBP-1 does not bind to the SH3 domain [ (PUBMED:7641887) ]. This entry also includes transmembrane protein 92 (TMEM92), whose function is not clear. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry WBP-1