The domain within your query sequence starts at position 168 and ends at position 245; the E-value for the WBS_methylT domain shown below is 1.3e-21.
SEQLELITTQATRAGFTGGVVVDFPNSAKAKKAPHKKARRDLVKKSREWVLEKKERRRRQ GKEVRPDTQYTGRKRKPR
WBS_methylT |
 |
|---|
| PFAM accession number: | PF12589 |
|---|---|
| Interpro abstract (IPR022238): | This entry represents the C-terminal domain of 18S rRNA (guanine(1575)-N(7))-methyltransferase Bud23 [ (PUBMED:18332120) ]. Bud23 homologues can be found from yeast to human. They are S-adenosyl-L-methionine-dependent methyltransferases that specifically methylates the N7 position of a guanine in 18S rRNA [ (PUBMED:25851604) ]. Bud23 homologue in Arabidopsis, known as Rid2 (ROOT INITIATION DEFECTIVE 2), is also involved in pre-rRNA processing [ (PUBMED:21401745) ]. In humans, Bud23 is located in the Williams-Beuren syndrome (WBS) critical region [ (PUBMED:11978965) ]. |
| GO process: | rRNA (guanine-N7)-methylation (GO:0070476) |
| GO function: | rRNA (guanine) methyltransferase activity (GO:0016435) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry WBS_methylT