The domain within your query sequence starts at position 12 and ends at position 93; the E-value for the WGG domain shown below is 7e-30.
LFGAAVRAALEAWPALQIAVENGFGGVHSQEKAEWLGGAVEDYFIANADLELEEIEDFLG ELMTTEFDTVVEDGSLPQVSQQ
WGG |
---|
PFAM accession number: | PF10273 |
---|---|
Interpro abstract (IPR019398): | The pre-rRNA-processing protein TSR2 is required for 20S pre-rRNA processing [ (PUBMED:12837249) ]. This family contains a distinctive WGG motif. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry WGG