The domain within your query sequence starts at position 1 and ends at position 43; the E-value for the WH1 domain shown below is 4.6e-11.
MTFTKTSQKFGQWADSRANTVFGLGFSSELQLTKFAEKFQEVR
WH1 |
---|
PFAM accession number: | PF00568 |
---|---|
Interpro abstract (IPR000697): | The EVH1 (WH1, RanBP1-WASP) domain is found in multi-domain proteins implicated in a diverse range of signalling, nuclear transport and cytoskeletal events. This domain of around 115 amino acids is present in species ranging from yeast to mammals. Many EVH1-containing proteins associate with actin-based structures and play a role in cytoskeletal organisation. EVH1 domains recognise and bind the proline-rich motif FPPPP with low-affinity, further interactions then form between flanking residues [ (PUBMED:11911879) (PUBMED:9312002) ]. WASP family proteins contain an EVH1 (WH1) in their N-terminals which bind proline-rich sequences in the WASP interacting protein. Proteins of the RanBP1 family contain a WH1 domain in their N-terminal region, which seems to bind a different sequence motif present in the C-terminal part of RanGTP protein [ (PUBMED:9883880) (PUBMED:7724562) ]. Tertiary structure of the WH1 domain of the Mena protein revealed structure similarities with the pleckstrin homology (PH) domain. The overall fold consists of a compact parallel beta-sandwich, closed along one edge by a long alpha-helix. A highly conserved cluster of three surface-exposed aromatic side-chains forms the recognition site for the molecules target ligands. [ (PUBMED:10338211) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry WH1