The domain within your query sequence starts at position 123 and ends at position 204; the E-value for the WSC domain shown below is 1.3e-20.
YLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDLARG RPAPATDCDQICFGHPGQLCGG
WSC |
---|
PFAM accession number: | PF01822 |
---|---|
Interpro abstract (IPR002889): | The WSC domain is a putative carbohydrate binding domain. The domain contains up to eight conserved cysteine residues that may be involved in disulphide bridges. The Trichoderma harzianum beta-1,3 exoglucanase contains two copies of the WSC domain, while the yeast SLG1 protein contains only one. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry WSC