The domain within your query sequence starts at position 1 and ends at position 56; the E-value for the XLF domain shown below is 7.2e-10.

VSQHLIHPLMGVSLALQSHVRELAALLRMKDLEIQAYQESGAVLSRSRLKTEPFEE

XLF

 XLF
PFAM accession number:PF09302
Interpro abstract (IPR015381):

XLF (also called Cernunnos) is involved in DNA nonhomologous end joining (NHEJ) required for double-strand break (DSB) repair and V(D)J recombination. XLF and XRCC4 form long helical protein filaments suitable for DNA end protection and alignment to facilitate DNA double strand break repair [ (PUBMED:23442139) ]. It directly interacts with the XRCC4-Ligase IV complex and siRNA-mediated downregulation of XLF in human cell lines leads to radio-sensitivity and impaired DNA non-homologous end-joining [ (PUBMED:16439205) ]. XLF is homologous to the yeast non-homologous end-joining factor Nej1 [ (PUBMED:16571728) ]. This family contains Nej1 (non-homologous end-joining factor) and Lif1.

GO process:double-strand break repair (GO:0006302)
GO component:nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry XLF