The domain within your query sequence starts at position 24 and ends at position 76; the E-value for the XPA_C domain shown below is 7.9e-29.
DKHKLITKTEAKQEYLLKDCDLEKREPALRFLVKKNPRHSQWGDMKLYLKLQV
XPA_C |
---|
PFAM accession number: | PF05181 |
---|---|
Interpro abstract (IPR022656): | Xeroderma pigmentosum (XP) [ (PUBMED:8160271) ] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30kDa nuclear protein called XPA (or XPAC) [ (PUBMED:1918083) ]. The sequence of the XPA protein is conserved from higher eukaryotes [ (PUBMED:1764072) ] to yeast (gene RAD14) [ (PUBMED:1741034) ]. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry represents the uncharacterised C-terminal domain of the XPA protein. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry XPA_C