The domain within your query sequence starts at position 1 and ends at position 151; the E-value for the XRCC1_N domain shown below is 6.9e-66.

MPEISLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDI
GNDGSAFVEVLVGSSAGGATAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRIFGPDKLVR
AAAEKRWDRVKIVCSQPYSKDSPYGLSFVKF

XRCC1_N

 XRCC1_N
PFAM accession number:PF01834
Interpro abstract (IPR002706):

DNA-repair protein Xrcc1 functions in the repair of single-strand DNA breaks in mammalian cells and forms a repair complex with beta-Pol, ligase III and PARP [ (PUBMED:10467087) ]. The NMR solution structure of the Xrcc1 N-terminal domain (Xrcc1 NTD) shows that the structural core is a beta-sandwich with beta-strands connected by loops, three helices and two short two-stranded beta-sheets at each connection side. The Xrcc1 NTD specifically binds single-strand break DNA (gapped and nicked) and a gapped DNA-beta-Pol complex [ (PUBMED:10467102) ].

GO process:single strand break repair (GO:0000012)
GO component:nucleus (GO:0005634)
GO function:damaged DNA binding (GO:0003684)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry XRCC1_N