The domain within your query sequence starts at position 1 and ends at position 62; the E-value for the XRCC1_N domain shown below is 4.4e-22.
XPATMLMSRTDSKSGKNRSGVRMFKDGDFLTPASGESWDRLRLTCSQPFTRHQSFGLAFL RV
XRCC1_N |
---|
PFAM accession number: | PF01834 |
---|---|
Interpro abstract (IPR002706): | DNA-repair protein Xrcc1 functions in the repair of single-strand DNA breaks in mammalian cells and forms a repair complex with beta-Pol, ligase III and PARP [ (PUBMED:10467087) ]. The NMR solution structure of the Xrcc1 N-terminal domain (Xrcc1 NTD) shows that the structural core is a beta-sandwich with beta-strands connected by loops, three helices and two short two-stranded beta-sheets at each connection side. The Xrcc1 NTD specifically binds single-strand break DNA (gapped and nicked) and a gapped DNA-beta-Pol complex [ (PUBMED:10467102) ]. |
GO process: | single strand break repair (GO:0000012) |
GO component: | nucleus (GO:0005634) |
GO function: | damaged DNA binding (GO:0003684) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry XRCC1_N