The domain within your query sequence starts at position 1 and ends at position 228; the E-value for the XRN_N domain shown below is 4.9e-104.
MGVPKFYRWISERYPCLSEVVKEHQIPEFDNLYLDMNGIIHQCSHPNDDDVHFRISDDKI FTDIFHYLEVLFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRSAKEAEDKIKKAIEKGE TLPTEARFDSNCITPGTEFMARLHEHLKYFVNMKISTDKSWQGVTIYFSGHETPGEGEHK IMEFIRSEKAKPDHDPNTRHCLYGLDADLIMLGLTSHEAHFSLLREEV
XRN_N |
![]() |
---|
PFAM accession number: | PF03159 |
---|---|
Interpro abstract (IPR004859): | Signatures of this entry align residues towards the N terminus of several proteins with multiple functions. The members of this family all appear to possess 5'-3' exonuclease activity EC 3.1.11 . Thus, the aligned region may be necessary for 5'-3' exonuclease function. |
GO function: | exonuclease activity (GO:0004527), nucleic acid binding (GO:0003676) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry XRN_N