The domain within your query sequence starts at position 2 and ends at position 39; the E-value for the XTBD domain shown below is 1.1e-11.
GRLDQLLSLSMVWANHLFLGCSPEDFLSRVCLKSISSC
XTBD |
---|
PFAM accession number: | PF11952 |
---|---|
Interpro abstract (IPR021859): | XRN2 is an essential eukaryotic exoribonuclease that processes and degrades various substrates. The ~80-residue XRN2-binding domain (XTBD) constitutes an XRN2-binding module that is employed by different metazoan proteins to link to XRN2 [ (PUBMED:24462208) (PUBMED:26779609) ], such as:
The XTBD domain folds into a globular four-helix bundle (H1-H4) connected by three loops (L1-L3). H1-H3 form an antiparallel helical array and H4 folds back on top of H2 and H3 at a 90degree angle. The four-helical bundle is mainly stabilized by hydrophobic helix-helix interactions together with additional polar interactions between side chains located on neighbouring helices. The four-helix bundle of XTBD represents a structurally unique arrangement for XRN2 binding [ (PUBMED:26779609) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry XTBD