The domain within your query sequence starts at position 50 and ends at position 122; the E-value for the Xan_ur_permease domain shown below is 4.6e-12.
LSCLLALQHFLVLASLLWASHLLLLHGLPPGGLSYPPAQLLASSFFSCGLSTVLQTWMGS RLPLIQAPSLEFL
Xan_ur_permease |
![]() |
---|
PFAM accession number: | PF00860 |
---|---|
Interpro abstract (IPR006043): | This entry represents a susbset of the wider APC (Amino acid-Polyamine-organoCation) superfamily of transporters [ (PUBMED:10931886) ]. Characterised proteins in this entry include:
These proteins generally contain 12 transmembrane regions. Many members of this family are uncharacterised and may transport other substrates eg. RutG is likely to transport pyrimidines into the cell [ (PUBMED:16540542) ]. |
GO process: | transmembrane transport (GO:0055085) |
GO component: | membrane (GO:0016020) |
GO function: | transmembrane transporter activity (GO:0022857) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Xan_ur_permease