The domain within your query sequence starts at position 519 and ends at position 594; the E-value for the Xylo_C domain shown below is 2.4e-19.
DFHLYGSYPPSTPALKAYWENIYDVADGPGGLSDVLLTAYTAFARLSLRHAATAVSPLAT AVCRLVLSGTPKNVSS
Xylo_C |
 |
|---|
| PFAM accession number: | PF12529 |
|---|---|
| Interpro abstract (IPR024448): | This domain is found in metazoan xylosyltransferases, which include xylosyltransferase 1 and xylosyltransferase 2. These enzymes initiate the biosynthesis of glycosaminoglycan chains in proteoglycans by transferring xylose from UDP-xylose to specific serine residues of the core protein [ (PUBMED:11099377) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Xylo_C