The domain within your query sequence starts at position 37 and ends at position 224; the E-value for the YhhN domain shown below is 9.8e-48.

WVSALIKCLPIFCLWLFLLAHGVRFLLAHPSASLIFVGLVFSAVGDAFLIWQDHGYFEHG
LLMFAVAHILYAAAFGMRPLALRTGLVIGVLSGLCYALLYPGLSGAFTYLVGVYVALISF
MGWRAMAGLRLVGAAWRWTELAAGGGALLFILSDLTIALNKFCFPVPYSRALIMSTYYAA
QMLIALSA

YhhN

 YhhN
PFAM accession number:PF07947
Interpro abstract (IPR012506):

The members of this family are similar to the hypothetical protein yhhN expressed by E. coli ( P0ADI9 ). Many are annotated as possible transmembrane proteins, and in fact they all have a high proportion of hydrophobic residues. A human member of this family, formerly known as TMEM86B, is a lysoplasmalogenase that catalyzes the hydrolysis of the vinyl ether bond of lysoplasmalogen [ (PUBMED:21515882) ]. Putative conserved active site residues have been proposed for the YhhN family [ (PUBMED:26335199) ].

GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry YhhN