The domain within your query sequence starts at position 5 and ends at position 79; the E-value for the Yos1 domain shown below is 1e-23.

LYSLMQAALLCISVLQEEHFLKNIGWGTDQGISGFGEESGIKSQLMNLIRSVRTVMRVPL
TIVSSITIVLLLLFG

Yos1

Yos1
PFAM accession number:PF08571
Interpro abstract (IPR013880):

In yeast, Yos1 is a subunit of the Yip1p-Yif1p complex and is required for transport between the endoplasmic reticulum and the Golgi complex [ (PUBMED:15659647) ].

This entry also includes animal IER3IP1 (immediate Early Response 3 Interacting Protein 1), which is localized to the endoplasmic reticulum. Mutations in the IER3IP1 gene cause permanent neonatal diabetes mellitus in human [ (PUBMED:28915629) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Yos1