The domain within your query sequence starts at position 5 and ends at position 79; the E-value for the Yos1 domain shown below is 1e-23.
LYSLMQAALLCISVLQEEHFLKNIGWGTDQGISGFGEESGIKSQLMNLIRSVRTVMRVPL TIVSSITIVLLLLFG
Yos1 |
---|
PFAM accession number: | PF08571 |
---|---|
Interpro abstract (IPR013880): | In yeast, Yos1 is a subunit of the Yip1p-Yif1p complex and is required for transport between the endoplasmic reticulum and the Golgi complex [ (PUBMED:15659647) ]. This entry also includes animal IER3IP1 (immediate Early Response 3 Interacting Protein 1), which is localized to the endoplasmic reticulum. Mutations in the IER3IP1 gene cause permanent neonatal diabetes mellitus in human [ (PUBMED:28915629) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Yos1