The domain within your query sequence starts at position 1 and ends at position 231; the E-value for the Zfx_Zfy_act domain shown below is 5.9e-76.
XVTNSDTETVIQAGGGVPGSTVTIKTEEDDDDDVKSTSEDYLMISLDDVGEKLEHMGNTP LKIASDGSQEDVKEDAFGSEVIKVYIFKAEAEDDVEIGGTEIVTESEYSSGHSVAGVLDQ SRMQREKMVYMAVKDSSQEQDDISNADISNELCMEVIIGEEEGTPLEIPLQDCDVNKTGS PVLSPASYDERRVSRRYEECQAPGNTFDSALENRNTTAAQYLQICDSMNTN
Zfx_Zfy_act |
---|
PFAM accession number: | PF04704 |
---|---|
Interpro abstract (IPR006794): | Zfx and Zfy are transcription factors implicated in mammalian sex determination. This region is found N-terminal to multiple copies of a C2H2 Zinc finger. This region has been shown to activate transcription when fused to a GAL4 DNA binding domain [ (PUBMED:2105457) ]. |
GO process: | regulation of transcription, DNA-templated (GO:0006355) |
GO component: | nucleus (GO:0005634) |
GO function: | metal ion binding (GO:0046872), DNA binding (GO:0003677) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Zfx_Zfy_act