The domain within your query sequence starts at position 382 and ends at position 511; the E-value for the Zip domain shown below is 2.5e-17.
MLGTALVLFHSCEENYSLILQLFVGLAVGTLSGDALLHLIPQVLGLHKQEAEFGHFHESQ SPIWKLLGLLGGIHGFFLIEKCFILLVSPNTKKGPEDSQTTVLPIGNVPASNRNGKTISL LAIMILVGDS
Zip |
---|
PFAM accession number: | PF02535 |
---|---|
Interpro abstract (IPR003689): | These ZIP zinc transporter proteins define a family of metal ion transporters that are found in plants, protozoa, fungi, invertebrates, and vertebrates, making it now possible to address questions of metal ion accumulation and homeostasis in diverse organisms [ (PUBMED:9618566) ]. |
GO process: | transmembrane transport (GO:0055085), metal ion transport (GO:0030001) |
GO component: | membrane (GO:0016020) |
GO function: | metal ion transmembrane transporter activity (GO:0046873) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Zip