The domain within your query sequence starts at position 83 and ends at position 291; the E-value for the Zw10 domain shown below is 2.2e-8.

LAQLMDSETDMVRQIRALDSDMQTLVYENYNKFISATDTIRKMKNDFRKMEDEMDRLATN
MAVITNFSARISATLQDRHERITKLAGVHALLRKLQFLFELPSRLTKCVELGAYGQAVRY
QGRARAVLQQYQHLPSFRAIQDDCQVITARLAQQLRQRFREGCSGAPEQAECVELLLALG
EPAEELCEEFLAHARGRLEEELSSLEAEL

Zw10

 Zw10
PFAM accession number:PF06248
Interpro abstract (IPR009361):

Zeste white 10 (ZW10) was initially identified as a mitotic checkpoint protein involved in chromosome segregation, and then implicated in targeting cytoplasmic dynein and dynactin to mitotic kinetochores, but it is also important in non-dividing cells. These include cytoplasmic dynein targeting to Golgi and other membranes, and SNARE-mediated ER-Golgi trafficking [ (PUBMED:17102640) (PUBMED:16505164) ]. Dominant-negative ZW10, anti-ZW10 antibody, and ZW10 RNA interference (RNAi) cause Golgi dispersal. ZW10 RNAi also disperse endosomes and lysosomes [ (PUBMED:16505164) ].

Drosophila kinetochore components Rough deal (Rod) and Zw10 are required for the proper functioning of the metaphase checkpoint in flies [ (PUBMED:11146659) ]. The eukaryotic spindle assembly checkpoint (SAC) monitors microtubule attachment to kinetochores and prevents anaphase onset until all kinetochores are aligned on the metaphase plate. It is an essential surveillance mechanism that ensures high fidelity chromosome segregation during mitosis. In higher eukaryotes, cytoplasmic dynein is involved in silencing the SAC by removing the checkpoint proteins Mad2 and the Rod-Zw10-Zwilch complex (RZZ) from aligned kinetochores [ (PUBMED:17576797) (PUBMED:18268100) (PUBMED:17509882) ].

GO process:mitotic cell cycle (GO:0000278)
GO component:nucleus (GO:0005634), chromosome, centromeric region (GO:0000775)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Zw10