The domain within your query sequence starts at position 199 and ends at position 251; the E-value for the eIF2A domain shown below is 1.5e-16.

KSFFKADKVTMLWNKKATAVLVIASTEVDKTGASYYGEQTLHYIATNGESAVV

eIF2A

• PFAM accession number: PF08662
• Interpro abstract (IPR013979):

  This entry contains beta propellor domains found in eukaryotic translation initiation factors and WD domain-containing proteins.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry eIF2A