The domain within your query sequence starts at position 33 and ends at position 123; the E-value for the ig domain shown below is 7e-18.
GMTFKILCISCKRRSETTAETFTEWTFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVW NGSRGTKDLQDLSIFITNVTYNHSGDYECHV
ig |
---|
PFAM accession number: | PF00047 |
---|---|
Interpro abstract (IPR013151): | This entry represents the immunoglobulin domain that is found in hundreds of proteins of different functions. Examples include antibodies, the giant muscle kinase titin and receptor tyrosine kinases. Immunoglobulin-like domains may be involved in protein-protein and protein-ligand interactions. This domain does not include the first and last strand of the immunoglobulin-like domain. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ig